Anti EMG1 pAb (ATL-HPA039666)

Atlas Antibodies

Catalog No.:
ATL-HPA039666-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: EMG1 N1-specific pseudouridine methyltransferase
Gene Name: EMG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004268: 90%, ENSRNOG00000012828: 90%
Entrez Gene ID: 10436
Uniprot ID: Q92979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKLTTAFEEVW
Gene Sequence SDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKLTTAFEEVW
Gene ID - Mouse ENSMUSG00000004268
Gene ID - Rat ENSRNOG00000012828
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EMG1 pAb (ATL-HPA039666)
Datasheet Anti EMG1 pAb (ATL-HPA039666) Datasheet (External Link)
Vendor Page Anti EMG1 pAb (ATL-HPA039666) at Atlas Antibodies

Documents & Links for Anti EMG1 pAb (ATL-HPA039666)
Datasheet Anti EMG1 pAb (ATL-HPA039666) Datasheet (External Link)
Vendor Page Anti EMG1 pAb (ATL-HPA039666)