Anti EMG1 pAb (ATL-HPA039666)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039666-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EMG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004268: 90%, ENSRNOG00000012828: 90%
Entrez Gene ID: 10436
Uniprot ID: Q92979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKLTTAFEEVW |
| Gene Sequence | SDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKLTTAFEEVW |
| Gene ID - Mouse | ENSMUSG00000004268 |
| Gene ID - Rat | ENSRNOG00000012828 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EMG1 pAb (ATL-HPA039666) | |
| Datasheet | Anti EMG1 pAb (ATL-HPA039666) Datasheet (External Link) |
| Vendor Page | Anti EMG1 pAb (ATL-HPA039666) at Atlas Antibodies |
| Documents & Links for Anti EMG1 pAb (ATL-HPA039666) | |
| Datasheet | Anti EMG1 pAb (ATL-HPA039666) Datasheet (External Link) |
| Vendor Page | Anti EMG1 pAb (ATL-HPA039666) |