Anti EME2 pAb (ATL-HPA045770)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045770-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EME2
Alternative Gene Name: FLJ00151, SLX2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073436: 69%, ENSRNOG00000024867: 69%
Entrez Gene ID: 197342
Uniprot ID: A4GXA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQFSRVS |
Gene Sequence | ALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQFSRVS |
Gene ID - Mouse | ENSMUSG00000073436 |
Gene ID - Rat | ENSRNOG00000024867 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EME2 pAb (ATL-HPA045770) | |
Datasheet | Anti EME2 pAb (ATL-HPA045770) Datasheet (External Link) |
Vendor Page | Anti EME2 pAb (ATL-HPA045770) at Atlas Antibodies |
Documents & Links for Anti EME2 pAb (ATL-HPA045770) | |
Datasheet | Anti EME2 pAb (ATL-HPA045770) Datasheet (External Link) |
Vendor Page | Anti EME2 pAb (ATL-HPA045770) |