Anti EMC7 pAb (ATL-HPA010029 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA010029-25
  • Immunohistochemical staining of human Testis shows strong granular cytoplasmic positivity in Leydig cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and EMC7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412637).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ER membrane protein complex subunit 7
Gene Name: EMC7
Alternative Gene Name: C11orf3, C15orf24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055943: 100%, ENSRNOG00000005884: 100%
Entrez Gene ID: 56851
Uniprot ID: Q9NPA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGK
Gene Sequence DMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGK
Gene ID - Mouse ENSMUSG00000055943
Gene ID - Rat ENSRNOG00000005884
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EMC7 pAb (ATL-HPA010029 w/enhanced validation)
Datasheet Anti EMC7 pAb (ATL-HPA010029 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EMC7 pAb (ATL-HPA010029 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EMC7 pAb (ATL-HPA010029 w/enhanced validation)
Datasheet Anti EMC7 pAb (ATL-HPA010029 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EMC7 pAb (ATL-HPA010029 w/enhanced validation)