Anti EMC4 pAb (ATL-HPA026868)

Atlas Antibodies

SKU:
ATL-HPA026868-25
  • Immunofluorescent staining of human cell line HeLa shows localization to focal adhesion sites.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ER membrane protein complex subunit 4
Gene Name: EMC4
Alternative Gene Name: FLJ90746, MGC24415, PIG17, TMEM85
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027131: 100%, ENSRNOG00000005719: 99%
Entrez Gene ID: 51234
Uniprot ID: Q5J8M3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPM
Gene Sequence LVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPM
Gene ID - Mouse ENSMUSG00000027131
Gene ID - Rat ENSRNOG00000005719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EMC4 pAb (ATL-HPA026868)
Datasheet Anti EMC4 pAb (ATL-HPA026868) Datasheet (External Link)
Vendor Page Anti EMC4 pAb (ATL-HPA026868) at Atlas Antibodies

Documents & Links for Anti EMC4 pAb (ATL-HPA026868)
Datasheet Anti EMC4 pAb (ATL-HPA026868) Datasheet (External Link)
Vendor Page Anti EMC4 pAb (ATL-HPA026868)