Anti EMC3 pAb (ATL-HPA042372)

Atlas Antibodies

Catalog No.: ATL-HPA042372-25

Protein Description: ER membrane protein complex subunit 3
Gene Name: EMC3
Alternative Gene Name: TMEM111
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030286: 100%, ENSRNOG00000009934: 100%
Entrez Gene ID: 55831
Uniprot ID: Q9P0I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVSDSQVLIRSRVLRENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTM
• Gene Sequence: QVSDSQVLIRSRVLRENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTM
• Gene ID - Mouse: ENSMUSG00000030286
• Gene ID - Rat: ENSRNOG00000009934
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EMC3 pAb (ATL-HPA042372) – 2 Found

Tang, Xiaofang; Snowball, John M; Xu, Yan; Na, Cheng-Lun; Weaver, Timothy E; Clair, Geremy; Kyle, Jennifer E; Zink, Erika M; Ansong, Charles; Wei, Wei; Huang, Meina; Lin, Xinhua; Whitsett, Jeffrey A. EMC3 coordinates surfactant protein and lipid homeostasis required for respiration. The Journal Of Clinical Investigation. 2017;127(12):4314-4325. 

Cao, Xiaowen; An, Jianhong; Cao, Yuqing; Lv, Juan; Wang, Jiawei; Ding, Yang; Lin, Xinhua; Zhou, Xiangtian. EMC3 Is Essential for Retinal Organization and Neurogenesis During Mouse Retinal Development. Investigative Ophthalmology & Visual Science. 2021;62(2):31.