Anti ELP6 pAb (ATL-HPA046358)

Atlas Antibodies

Catalog No.:
ATL-HPA046358-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: elongator acetyltransferase complex subunit 6
Gene Name: ELP6
Alternative Gene Name: C3orf75, FLJ20211, TMEM103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054836: 76%, ENSRNOG00000020847: 76%
Entrez Gene ID: 54859
Uniprot ID: Q0PNE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ
Gene Sequence VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ
Gene ID - Mouse ENSMUSG00000054836
Gene ID - Rat ENSRNOG00000020847
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELP6 pAb (ATL-HPA046358)
Datasheet Anti ELP6 pAb (ATL-HPA046358) Datasheet (External Link)
Vendor Page Anti ELP6 pAb (ATL-HPA046358) at Atlas Antibodies

Documents & Links for Anti ELP6 pAb (ATL-HPA046358)
Datasheet Anti ELP6 pAb (ATL-HPA046358) Datasheet (External Link)
Vendor Page Anti ELP6 pAb (ATL-HPA046358)