Anti ELP5 pAb (ATL-HPA023279)

Atlas Antibodies

Catalog No.:
ATL-HPA023279-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: elongator acetyltransferase complex subunit 5
Gene Name: ELP5
Alternative Gene Name: C17orf81, DERP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018565: 82%, ENSRNOG00000027628: 79%
Entrez Gene ID: 23587
Uniprot ID: Q8TE02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFREGFDSDINNRL
Gene Sequence GTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFREGFDSDINNRL
Gene ID - Mouse ENSMUSG00000018565
Gene ID - Rat ENSRNOG00000027628
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELP5 pAb (ATL-HPA023279)
Datasheet Anti ELP5 pAb (ATL-HPA023279) Datasheet (External Link)
Vendor Page Anti ELP5 pAb (ATL-HPA023279) at Atlas Antibodies

Documents & Links for Anti ELP5 pAb (ATL-HPA023279)
Datasheet Anti ELP5 pAb (ATL-HPA023279) Datasheet (External Link)
Vendor Page Anti ELP5 pAb (ATL-HPA023279)
Citations for Anti ELP5 pAb (ATL-HPA023279) – 2 Found
Xu, Sunwang; Jiang, Cen; Lin, Ruirong; Wang, Xiaopeng; Hu, Xiaoqiang; Chen, Wei; Chen, Xiangjin; Chen, Tao. Epigenetic activation of the elongator complex sensitizes gallbladder cancer to gemcitabine therapy. Journal Of Experimental & Clinical Cancer Research : Cr. 2021;40(1):373.  PubMed
Xu, Sunwang; Zhan, Ming; Jiang, Cen; He, Min; Yang, Linhua; Shen, Hui; Huang, Shuai; Huang, Xince; Lin, Ruirong; Shi, Yongheng; Liu, Qiang; Chen, Wei; Mohan, Man; Wang, Jian. Genome-wide CRISPR screen identifies ELP5 as a determinant of gemcitabine sensitivity in gallbladder cancer. Nature Communications. 2019;10(1):5492.  PubMed