Anti ELP4 pAb (ATL-HPA038573)

Atlas Antibodies

Catalog No.: ATL-HPA038573-25

Protein Description: elongator acetyltransferase complex subunit 4
Gene Name: ELP4
Alternative Gene Name: C11orf19, PAXNEB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027167: 81%, ENSRNOG00000004787: 82%
Entrez Gene ID: 26610
Uniprot ID: Q96EB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKM
• Gene Sequence: EEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKM
• Gene ID - Mouse: ENSMUSG00000027167
• Gene ID - Rat: ENSRNOG00000004787
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.