Anti ELP4 pAb (ATL-HPA038573)

Atlas Antibodies

SKU:
ATL-HPA038573-25
  • Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: elongator acetyltransferase complex subunit 4
Gene Name: ELP4
Alternative Gene Name: C11orf19, PAXNEB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027167: 81%, ENSRNOG00000004787: 82%
Entrez Gene ID: 26610
Uniprot ID: Q96EB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKM
Gene Sequence EEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKM
Gene ID - Mouse ENSMUSG00000027167
Gene ID - Rat ENSRNOG00000004787
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ELP4 pAb (ATL-HPA038573)
Datasheet Anti ELP4 pAb (ATL-HPA038573) Datasheet (External Link)
Vendor Page Anti ELP4 pAb (ATL-HPA038573) at Atlas Antibodies

Documents & Links for Anti ELP4 pAb (ATL-HPA038573)
Datasheet Anti ELP4 pAb (ATL-HPA038573) Datasheet (External Link)
Vendor Page Anti ELP4 pAb (ATL-HPA038573)