Anti ELP4 pAb (ATL-HPA038572)

Atlas Antibodies

SKU: ATL-HPA038572-100

• 
• 
• 

Protein Description: elongator acetyltransferase complex subunit 4
Gene Name: ELP4
Alternative Gene Name: C11orf19, PAXNEB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027167: 86%, ENSRNOG00000016146: 84%
Entrez Gene ID: 26610
Uniprot ID: Q96EB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKD
• Gene Sequence: YVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKD
• Gene ID - Mouse: ENSMUSG00000027167
• Gene ID - Rat: ENSRNOG00000016146
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.