Anti ELP3 pAb (ATL-HPA025812)

Atlas Antibodies

Catalog No.:
ATL-HPA025812-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: elongator acetyltransferase complex subunit 3
Gene Name: ELP3
Alternative Gene Name: FLJ10422, KAT9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022031: 96%, ENSRNOG00000014291: 95%
Entrez Gene ID: 55140
Uniprot ID: Q9H9T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRR
Gene Sequence ELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRR
Gene ID - Mouse ENSMUSG00000022031
Gene ID - Rat ENSRNOG00000014291
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELP3 pAb (ATL-HPA025812)
Datasheet Anti ELP3 pAb (ATL-HPA025812) Datasheet (External Link)
Vendor Page Anti ELP3 pAb (ATL-HPA025812) at Atlas Antibodies

Documents & Links for Anti ELP3 pAb (ATL-HPA025812)
Datasheet Anti ELP3 pAb (ATL-HPA025812) Datasheet (External Link)
Vendor Page Anti ELP3 pAb (ATL-HPA025812)