Anti ELOVL7 pAb (ATL-HPA036337)

Atlas Antibodies

Catalog No.:
ATL-HPA036337-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ELOVL fatty acid elongase 7
Gene Name: ELOVL7
Alternative Gene Name: FLJ23563
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021696: 90%, ENSRNOG00000009773: 48%
Entrez Gene ID: 79993
Uniprot ID: A1L3X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAFSDLTSRTVHLYDNWIKDADPRVEDWLLM
Gene Sequence MAFSDLTSRTVHLYDNWIKDADPRVEDWLLM
Gene ID - Mouse ENSMUSG00000021696
Gene ID - Rat ENSRNOG00000009773
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELOVL7 pAb (ATL-HPA036337)
Datasheet Anti ELOVL7 pAb (ATL-HPA036337) Datasheet (External Link)
Vendor Page Anti ELOVL7 pAb (ATL-HPA036337) at Atlas Antibodies

Documents & Links for Anti ELOVL7 pAb (ATL-HPA036337)
Datasheet Anti ELOVL7 pAb (ATL-HPA036337) Datasheet (External Link)
Vendor Page Anti ELOVL7 pAb (ATL-HPA036337)