Anti ELOVL7 pAb (ATL-HPA036337)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036337-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ELOVL7
Alternative Gene Name: FLJ23563
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021696: 90%, ENSRNOG00000009773: 48%
Entrez Gene ID: 79993
Uniprot ID: A1L3X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAFSDLTSRTVHLYDNWIKDADPRVEDWLLM |
Gene Sequence | MAFSDLTSRTVHLYDNWIKDADPRVEDWLLM |
Gene ID - Mouse | ENSMUSG00000021696 |
Gene ID - Rat | ENSRNOG00000009773 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ELOVL7 pAb (ATL-HPA036337) | |
Datasheet | Anti ELOVL7 pAb (ATL-HPA036337) Datasheet (External Link) |
Vendor Page | Anti ELOVL7 pAb (ATL-HPA036337) at Atlas Antibodies |
Documents & Links for Anti ELOVL7 pAb (ATL-HPA036337) | |
Datasheet | Anti ELOVL7 pAb (ATL-HPA036337) Datasheet (External Link) |
Vendor Page | Anti ELOVL7 pAb (ATL-HPA036337) |