Anti ELOVL5 pAb (ATL-HPA047752 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047752-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ELOVL5
Alternative Gene Name: dJ483K16.1, HELO1, SCA38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032349: 88%, ENSRNOG00000006331: 79%
Entrez Gene ID: 60481
Uniprot ID: Q9NYP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD |
| Gene Sequence | QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD |
| Gene ID - Mouse | ENSMUSG00000032349 |
| Gene ID - Rat | ENSRNOG00000006331 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELOVL5 pAb (ATL-HPA047752 w/enhanced validation) | |
| Datasheet | Anti ELOVL5 pAb (ATL-HPA047752 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ELOVL5 pAb (ATL-HPA047752 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ELOVL5 pAb (ATL-HPA047752 w/enhanced validation) | |
| Datasheet | Anti ELOVL5 pAb (ATL-HPA047752 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ELOVL5 pAb (ATL-HPA047752 w/enhanced validation) |
| Citations for Anti ELOVL5 pAb (ATL-HPA047752 w/enhanced validation) – 2 Found |
| Boot, Arnoud; Oosting, Jan; van Eendenburg, Jaap D H; Kuppen, Peter J K; Morreau, Hans; van Wezel, Tom. Methylation associated transcriptional repression of ELOVL5 in novel colorectal cancer cell lines. Plos One. 12(9):e0184900. PubMed |
| Kieu, Trinh-Le-Vi; Pierre, Léa; Derangère, Valentin; Perrey, Sabrina; Truntzer, Caroline; Jalil, Antoine; Causse, Sébastien; Groetz, Emma; Dumont, Adélie; Guyard, Laura; Arnould, Laurent; de Barros, Jean-Paul Pais; Apetoh, Lionel; Rébé, Cédric; Limagne, Emeric; Jourdan, Tony; Demizieux, Laurent; Masson, David; Thomas, Charles; Ghiringhelli, François; Rialland, Mickaël. Downregulation of Elovl5 promotes breast cancer metastasis through a lipid-droplet accumulation-mediated induction of TGF-β receptors. Cell Death & Disease. 2022;13(9):758. PubMed |