Anti ELOVL5 pAb (ATL-HPA047752 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047752-25

• 
• 
• 

Protein Description: ELOVL fatty acid elongase 5
Gene Name: ELOVL5
Alternative Gene Name: dJ483K16.1, HELO1, SCA38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032349: 88%, ENSRNOG00000006331: 79%
Entrez Gene ID: 60481
Uniprot ID: Q9NYP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
• Gene Sequence: QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
• Gene ID - Mouse: ENSMUSG00000032349
• Gene ID - Rat: ENSRNOG00000006331
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ELOVL5 pAb (ATL-HPA047752 w/enhanced validation) – 2 Found

Boot, Arnoud; Oosting, Jan; van Eendenburg, Jaap D H; Kuppen, Peter J K; Morreau, Hans; van Wezel, Tom. Methylation associated transcriptional repression of ELOVL5 in novel colorectal cancer cell lines. Plos One. 12(9):e0184900. 

Kieu, Trinh-Le-Vi; Pierre, Léa; Derangère, Valentin; Perrey, Sabrina; Truntzer, Caroline; Jalil, Antoine; Causse, Sébastien; Groetz, Emma; Dumont, Adélie; Guyard, Laura; Arnould, Laurent; de Barros, Jean-Paul Pais; Apetoh, Lionel; Rébé, Cédric; Limagne, Emeric; Jourdan, Tony; Demizieux, Laurent; Masson, David; Thomas, Charles; Ghiringhelli, François; Rialland, Mickaël. Downregulation of Elovl5 promotes breast cancer metastasis through a lipid-droplet accumulation-mediated induction of TGF-β receptors. Cell Death & Disease. 2022;13(9):758.