Anti ELOA2 pAb (ATL-HPA043501)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043501-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ELOA2
Alternative Gene Name: HsT832, TCEB3B, TCEB3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028668: 36%, ENSRNOG00000010902: 44%
Entrez Gene ID: 51224
Uniprot ID: Q8IYF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QKRPQHSHSNKKRPSLDGRDPGNGTHGLSPEEKEQLSNDRETQEGKPPTAHLDRTSVSSLSEVEEVDMAEEFEQPTLSCE |
Gene Sequence | QKRPQHSHSNKKRPSLDGRDPGNGTHGLSPEEKEQLSNDRETQEGKPPTAHLDRTSVSSLSEVEEVDMAEEFEQPTLSCE |
Gene ID - Mouse | ENSMUSG00000028668 |
Gene ID - Rat | ENSRNOG00000010902 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ELOA2 pAb (ATL-HPA043501) | |
Datasheet | Anti ELOA2 pAb (ATL-HPA043501) Datasheet (External Link) |
Vendor Page | Anti ELOA2 pAb (ATL-HPA043501) at Atlas Antibodies |
Documents & Links for Anti ELOA2 pAb (ATL-HPA043501) | |
Datasheet | Anti ELOA2 pAb (ATL-HPA043501) Datasheet (External Link) |
Vendor Page | Anti ELOA2 pAb (ATL-HPA043501) |