Anti ELOA2 pAb (ATL-HPA043501)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043501-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ELOA2
Alternative Gene Name: HsT832, TCEB3B, TCEB3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028668: 36%, ENSRNOG00000010902: 44%
Entrez Gene ID: 51224
Uniprot ID: Q8IYF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QKRPQHSHSNKKRPSLDGRDPGNGTHGLSPEEKEQLSNDRETQEGKPPTAHLDRTSVSSLSEVEEVDMAEEFEQPTLSCE |
| Gene Sequence | QKRPQHSHSNKKRPSLDGRDPGNGTHGLSPEEKEQLSNDRETQEGKPPTAHLDRTSVSSLSEVEEVDMAEEFEQPTLSCE |
| Gene ID - Mouse | ENSMUSG00000028668 |
| Gene ID - Rat | ENSRNOG00000010902 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELOA2 pAb (ATL-HPA043501) | |
| Datasheet | Anti ELOA2 pAb (ATL-HPA043501) Datasheet (External Link) |
| Vendor Page | Anti ELOA2 pAb (ATL-HPA043501) at Atlas Antibodies |
| Documents & Links for Anti ELOA2 pAb (ATL-HPA043501) | |
| Datasheet | Anti ELOA2 pAb (ATL-HPA043501) Datasheet (External Link) |
| Vendor Page | Anti ELOA2 pAb (ATL-HPA043501) |