Anti ELOA2 pAb (ATL-HPA043501)

Atlas Antibodies

Catalog No.:
ATL-HPA043501-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: elongin A2
Gene Name: ELOA2
Alternative Gene Name: HsT832, TCEB3B, TCEB3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028668: 36%, ENSRNOG00000010902: 44%
Entrez Gene ID: 51224
Uniprot ID: Q8IYF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QKRPQHSHSNKKRPSLDGRDPGNGTHGLSPEEKEQLSNDRETQEGKPPTAHLDRTSVSSLSEVEEVDMAEEFEQPTLSCE
Gene Sequence QKRPQHSHSNKKRPSLDGRDPGNGTHGLSPEEKEQLSNDRETQEGKPPTAHLDRTSVSSLSEVEEVDMAEEFEQPTLSCE
Gene ID - Mouse ENSMUSG00000028668
Gene ID - Rat ENSRNOG00000010902
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELOA2 pAb (ATL-HPA043501)
Datasheet Anti ELOA2 pAb (ATL-HPA043501) Datasheet (External Link)
Vendor Page Anti ELOA2 pAb (ATL-HPA043501) at Atlas Antibodies

Documents & Links for Anti ELOA2 pAb (ATL-HPA043501)
Datasheet Anti ELOA2 pAb (ATL-HPA043501) Datasheet (External Link)
Vendor Page Anti ELOA2 pAb (ATL-HPA043501)