Anti ELOA pAb (ATL-HPA005910)

Atlas Antibodies

SKU:
ATL-HPA005910-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol.
  • Western blot analysis in human cell line U-2197.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: elongin A
Gene Name: ELOA
Alternative Gene Name: SIII, TCEB3, TCEB3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028668: 67%, ENSRNOG00000010902: 69%
Entrez Gene ID: 6924
Uniprot ID: Q14241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASVVSREKSHKALSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPEKAKLDKSKQGLDSFDTGKGAGD
Gene Sequence ERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASVVSREKSHKALSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPEKAKLDKSKQGLDSFDTGKGAGD
Gene ID - Mouse ENSMUSG00000028668
Gene ID - Rat ENSRNOG00000010902
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ELOA pAb (ATL-HPA005910)
Datasheet Anti ELOA pAb (ATL-HPA005910) Datasheet (External Link)
Vendor Page Anti ELOA pAb (ATL-HPA005910) at Atlas Antibodies

Documents & Links for Anti ELOA pAb (ATL-HPA005910)
Datasheet Anti ELOA pAb (ATL-HPA005910) Datasheet (External Link)
Vendor Page Anti ELOA pAb (ATL-HPA005910)



Citations for Anti ELOA pAb (ATL-HPA005910) – 1 Found
Schoen, Andreas; Lau, Simone; Verbruggen, Paul; Weber, Friedemann. Elongin C Contributes to RNA Polymerase II Degradation by the Interferon Antagonist NSs of La Crosse Orthobunyavirus. Journal Of Virology. 2020;94(7)  PubMed