Anti ELMOD2 pAb (ATL-HPA047600)

Atlas Antibodies

Catalog No.:
ATL-HPA047600-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ELMO/CED-12 domain containing 2
Gene Name: ELMOD2
Alternative Gene Name: MGC10084
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035151: 70%, ENSRNOG00000011225: 67%
Entrez Gene ID: 255520
Uniprot ID: Q8IZ81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQ
Gene Sequence KATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQ
Gene ID - Mouse ENSMUSG00000035151
Gene ID - Rat ENSRNOG00000011225
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELMOD2 pAb (ATL-HPA047600)
Datasheet Anti ELMOD2 pAb (ATL-HPA047600) Datasheet (External Link)
Vendor Page Anti ELMOD2 pAb (ATL-HPA047600) at Atlas Antibodies

Documents & Links for Anti ELMOD2 pAb (ATL-HPA047600)
Datasheet Anti ELMOD2 pAb (ATL-HPA047600) Datasheet (External Link)
Vendor Page Anti ELMOD2 pAb (ATL-HPA047600)