Anti ELMOD2 pAb (ATL-HPA047600)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047600-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ELMOD2
Alternative Gene Name: MGC10084
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035151: 70%, ENSRNOG00000011225: 67%
Entrez Gene ID: 255520
Uniprot ID: Q8IZ81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQ |
| Gene Sequence | KATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQ |
| Gene ID - Mouse | ENSMUSG00000035151 |
| Gene ID - Rat | ENSRNOG00000011225 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELMOD2 pAb (ATL-HPA047600) | |
| Datasheet | Anti ELMOD2 pAb (ATL-HPA047600) Datasheet (External Link) |
| Vendor Page | Anti ELMOD2 pAb (ATL-HPA047600) at Atlas Antibodies |
| Documents & Links for Anti ELMOD2 pAb (ATL-HPA047600) | |
| Datasheet | Anti ELMOD2 pAb (ATL-HPA047600) Datasheet (External Link) |
| Vendor Page | Anti ELMOD2 pAb (ATL-HPA047600) |