Anti ELMOD2 pAb (ATL-HPA047600)

Atlas Antibodies

SKU: ATL-HPA047600-25

• 
• 
• 

Protein Description: ELMO/CED-12 domain containing 2
Gene Name: ELMOD2
Alternative Gene Name: MGC10084
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035151: 70%, ENSRNOG00000011225: 67%
Entrez Gene ID: 255520
Uniprot ID: Q8IZ81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQ
• Gene Sequence: KATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQ
• Gene ID - Mouse: ENSMUSG00000035151
• Gene ID - Rat: ENSRNOG00000011225
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.