Anti ELMO2 pAb (ATL-HPA018811)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018811-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ELMO2
Alternative Gene Name: CED-12, CED12, ELMO-2, FLJ11656, KIAA1834
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017670: 95%, ENSRNOG00000018747: 97%
Entrez Gene ID: 63916
Uniprot ID: Q96JJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD |
| Gene Sequence | CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD |
| Gene ID - Mouse | ENSMUSG00000017670 |
| Gene ID - Rat | ENSRNOG00000018747 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELMO2 pAb (ATL-HPA018811) | |
| Datasheet | Anti ELMO2 pAb (ATL-HPA018811) Datasheet (External Link) |
| Vendor Page | Anti ELMO2 pAb (ATL-HPA018811) at Atlas Antibodies |
| Documents & Links for Anti ELMO2 pAb (ATL-HPA018811) | |
| Datasheet | Anti ELMO2 pAb (ATL-HPA018811) Datasheet (External Link) |
| Vendor Page | Anti ELMO2 pAb (ATL-HPA018811) |
| Citations for Anti ELMO2 pAb (ATL-HPA018811) – 1 Found |
| Dayal, Jasbani H S; Cole, Clare L; Pourreyron, Celine; Watt, Stephen A; Lim, Yok Zuan; Salas-Alanis, Julio C; Murrell, Dedee F; McGrath, John A; Stieger, Bruno; Jahoda, Colin; Leigh, Irene M; South, Andrew P. Type VII collagen regulates expression of OATP1B3, promotes front-to-rear polarity and increases structural organisation in 3D spheroid cultures of RDEB tumour keratinocytes. Journal Of Cell Science. 2014;127(Pt 4):740-51. PubMed |