Anti ELMO2 pAb (ATL-HPA018811)

Atlas Antibodies

Catalog No.:
ATL-HPA018811-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: engulfment and cell motility 2
Gene Name: ELMO2
Alternative Gene Name: CED-12, CED12, ELMO-2, FLJ11656, KIAA1834
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017670: 95%, ENSRNOG00000018747: 97%
Entrez Gene ID: 63916
Uniprot ID: Q96JJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD
Gene Sequence CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD
Gene ID - Mouse ENSMUSG00000017670
Gene ID - Rat ENSRNOG00000018747
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELMO2 pAb (ATL-HPA018811)
Datasheet Anti ELMO2 pAb (ATL-HPA018811) Datasheet (External Link)
Vendor Page Anti ELMO2 pAb (ATL-HPA018811) at Atlas Antibodies

Documents & Links for Anti ELMO2 pAb (ATL-HPA018811)
Datasheet Anti ELMO2 pAb (ATL-HPA018811) Datasheet (External Link)
Vendor Page Anti ELMO2 pAb (ATL-HPA018811)
Citations for Anti ELMO2 pAb (ATL-HPA018811) – 1 Found
Dayal, Jasbani H S; Cole, Clare L; Pourreyron, Celine; Watt, Stephen A; Lim, Yok Zuan; Salas-Alanis, Julio C; Murrell, Dedee F; McGrath, John A; Stieger, Bruno; Jahoda, Colin; Leigh, Irene M; South, Andrew P. Type VII collagen regulates expression of OATP1B3, promotes front-to-rear polarity and increases structural organisation in 3D spheroid cultures of RDEB tumour keratinocytes. Journal Of Cell Science. 2014;127(Pt 4):740-51.  PubMed