Anti ELL3 pAb (ATL-HPA028938)

Atlas Antibodies

SKU:
ATL-HPA028938-25
  • Immunohistochemical staining of human Testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: elongation factor RNA polymerase II-like 3
Gene Name: ELL3
Alternative Gene Name: FLJ22637
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027246: 70%, ENSRNOG00000022868: 71%
Entrez Gene ID: 80237
Uniprot ID: Q9HB65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASN
Gene Sequence HRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASN
Gene ID - Mouse ENSMUSG00000027246
Gene ID - Rat ENSRNOG00000022868
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ELL3 pAb (ATL-HPA028938)
Datasheet Anti ELL3 pAb (ATL-HPA028938) Datasheet (External Link)
Vendor Page Anti ELL3 pAb (ATL-HPA028938) at Atlas Antibodies

Documents & Links for Anti ELL3 pAb (ATL-HPA028938)
Datasheet Anti ELL3 pAb (ATL-HPA028938) Datasheet (External Link)
Vendor Page Anti ELL3 pAb (ATL-HPA028938)