Anti ELL pAb (ATL-HPA046076)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046076-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ELL
Alternative Gene Name: C19orf17, ELL1, Men, PPP1R68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070002: 73%, ENSRNOG00000019824: 74%
Entrez Gene ID: 8178
Uniprot ID: P55199
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLG |
| Gene Sequence | ANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLG |
| Gene ID - Mouse | ENSMUSG00000070002 |
| Gene ID - Rat | ENSRNOG00000019824 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELL pAb (ATL-HPA046076) | |
| Datasheet | Anti ELL pAb (ATL-HPA046076) Datasheet (External Link) |
| Vendor Page | Anti ELL pAb (ATL-HPA046076) at Atlas Antibodies |
| Documents & Links for Anti ELL pAb (ATL-HPA046076) | |
| Datasheet | Anti ELL pAb (ATL-HPA046076) Datasheet (External Link) |
| Vendor Page | Anti ELL pAb (ATL-HPA046076) |
| Citations for Anti ELL pAb (ATL-HPA046076) – 1 Found |
| Chen, Yu; Zhou, Chi; Ji, Wei; Mei, Zhichao; Hu, Bo; Zhang, Wei; Zhang, Dawei; Wang, Jing; Liu, Xing; Ouyang, Gang; Zhou, Jiangang; Xiao, Wuhan. ELL targets c-Myc for proteasomal degradation and suppresses tumour growth. Nature Communications. 2016;7( 27009366):11057. PubMed |