Anti ELL pAb (ATL-HPA046076)

Atlas Antibodies

Catalog No.:
ATL-HPA046076-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: elongation factor RNA polymerase II
Gene Name: ELL
Alternative Gene Name: C19orf17, ELL1, Men, PPP1R68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070002: 73%, ENSRNOG00000019824: 74%
Entrez Gene ID: 8178
Uniprot ID: P55199
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLG
Gene Sequence ANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLG
Gene ID - Mouse ENSMUSG00000070002
Gene ID - Rat ENSRNOG00000019824
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELL pAb (ATL-HPA046076)
Datasheet Anti ELL pAb (ATL-HPA046076) Datasheet (External Link)
Vendor Page Anti ELL pAb (ATL-HPA046076) at Atlas Antibodies

Documents & Links for Anti ELL pAb (ATL-HPA046076)
Datasheet Anti ELL pAb (ATL-HPA046076) Datasheet (External Link)
Vendor Page Anti ELL pAb (ATL-HPA046076)
Citations for Anti ELL pAb (ATL-HPA046076) – 1 Found
Chen, Yu; Zhou, Chi; Ji, Wei; Mei, Zhichao; Hu, Bo; Zhang, Wei; Zhang, Dawei; Wang, Jing; Liu, Xing; Ouyang, Gang; Zhou, Jiangang; Xiao, Wuhan. ELL targets c-Myc for proteasomal degradation and suppresses tumour growth. Nature Communications. 2016;7( 27009366):11057.  PubMed