Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001600-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ELK3
Alternative Gene Name: ERP, NET, SAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008398: 88%, ENSRNOG00000004367: 91%
Entrez Gene ID: 2004
Uniprot ID: P41970
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTR |
Gene Sequence | KNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTR |
Gene ID - Mouse | ENSMUSG00000008398 |
Gene ID - Rat | ENSRNOG00000004367 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) | |
Datasheet | Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) | |
Datasheet | Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) |
Citations for Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) – 4 Found |
Semenchenko, Kostyantyn; Wasylyk, Christine; Cheung, Henry; Tourrette, Yves; Maas, Peter; Schalken, Jack A; van der Pluijm, Gabri; Wasylyk, Bohdan. XRP44X, an Inhibitor of Ras/Erk Activation of the Transcription Factor Elk3, Inhibits Tumour Growth and Metastasis in Mice. Plos One. 11(7):e0159531. PubMed |
Zhao, Qiuyan; Ren, Yingchun; Xie, Haoran; Yu, Lanting; Lu, Jiawei; Jiang, Weiliang; Xiao, Wenqin; Zhu, Zhonglin; Wan, Rong; Li, Baiwen. ELK3 Mediated by ZEB1 Facilitates the Growth and Metastasis of Pancreatic Carcinoma by Activating the Wnt/β-Catenin Pathway. Frontiers In Cell And Developmental Biology. 9( 34409034):700192. PubMed |
Liu, Zhendong; Ren, Zhishuai; Zhang, Cheng; Qian, Rongjun; Wang, Hongbo; Wang, Jialin; Zhang, Wang; Liu, Binfeng; Lian, Xiaoyu; Wang, Yanbiao; Guo, Yuqi; Gao, Yanzheng. ELK3: A New Molecular Marker for the Diagnosis and Prognosis of Glioma. Frontiers In Oncology. 11( 34976781):608748. PubMed |
Robertson, E Douglas; Wasylyk, Christine; Ye, Tao; Jung, Alain C; Wasylyk, Bohdan. The oncogenic MicroRNA Hsa-miR-155-5p targets the transcription factor ELK3 and links it to the hypoxia response. Plos One. 9(11):e113050. PubMed |