Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001600-25

• 
• 
• 

Protein Description: ELK3, ETS-domain protein (SRF accessory protein 2)
Gene Name: ELK3
Alternative Gene Name: ERP, NET, SAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008398: 88%, ENSRNOG00000004367: 91%
Entrez Gene ID: 2004
Uniprot ID: P41970
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTR
• Gene Sequence: KNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTR
• Gene ID - Mouse: ENSMUSG00000008398
• Gene ID - Rat: ENSRNOG00000004367
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ELK3 pAb (ATL-HPA001600 w/enhanced validation) – 4 Found

Semenchenko, Kostyantyn; Wasylyk, Christine; Cheung, Henry; Tourrette, Yves; Maas, Peter; Schalken, Jack A; van der Pluijm, Gabri; Wasylyk, Bohdan. XRP44X, an Inhibitor of Ras/Erk Activation of the Transcription Factor Elk3, Inhibits Tumour Growth and Metastasis in Mice. Plos One. 11(7):e0159531. 

Zhao, Qiuyan; Ren, Yingchun; Xie, Haoran; Yu, Lanting; Lu, Jiawei; Jiang, Weiliang; Xiao, Wenqin; Zhu, Zhonglin; Wan, Rong; Li, Baiwen. ELK3 Mediated by ZEB1 Facilitates the Growth and Metastasis of Pancreatic Carcinoma by Activating the Wnt/β-Catenin Pathway. Frontiers In Cell And Developmental Biology. 9( 34409034):700192. 

Liu, Zhendong; Ren, Zhishuai; Zhang, Cheng; Qian, Rongjun; Wang, Hongbo; Wang, Jialin; Zhang, Wang; Liu, Binfeng; Lian, Xiaoyu; Wang, Yanbiao; Guo, Yuqi; Gao, Yanzheng. ELK3: A New Molecular Marker for the Diagnosis and Prognosis of Glioma. Frontiers In Oncology. 11( 34976781):608748. 

Robertson, E Douglas; Wasylyk, Christine; Ye, Tao; Jung, Alain C; Wasylyk, Bohdan. The oncogenic MicroRNA Hsa-miR-155-5p targets the transcription factor ELK3 and links it to the hypoxia response. Plos One. 9(11):e113050.