Anti ELAC1 pAb (ATL-HPA040867)

Atlas Antibodies

Catalog No.:
ATL-HPA040867-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: elaC ribonuclease Z 1
Gene Name: ELAC1
Alternative Gene Name: D29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036941: 94%, ENSRNOG00000000113: 93%
Entrez Gene ID: 55520
Uniprot ID: Q9H777
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLENGVTISPQDVLKKPIVGRKICILGDCSGVVGDGGVKLCFEADLL
Gene Sequence SVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLENGVTISPQDVLKKPIVGRKICILGDCSGVVGDGGVKLCFEADLL
Gene ID - Mouse ENSMUSG00000036941
Gene ID - Rat ENSRNOG00000000113
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ELAC1 pAb (ATL-HPA040867)
Datasheet Anti ELAC1 pAb (ATL-HPA040867) Datasheet (External Link)
Vendor Page Anti ELAC1 pAb (ATL-HPA040867) at Atlas Antibodies

Documents & Links for Anti ELAC1 pAb (ATL-HPA040867)
Datasheet Anti ELAC1 pAb (ATL-HPA040867) Datasheet (External Link)
Vendor Page Anti ELAC1 pAb (ATL-HPA040867)