Anti ELAC1 pAb (ATL-HPA040867)

Atlas Antibodies

SKU: ATL-HPA040867-100

• 
• 

Protein Description: elaC ribonuclease Z 1
Gene Name: ELAC1
Alternative Gene Name: D29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036941: 94%, ENSRNOG00000000113: 93%
Entrez Gene ID: 55520
Uniprot ID: Q9H777
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLENGVTISPQDVLKKPIVGRKICILGDCSGVVGDGGVKLCFEADLL
• Gene Sequence: SVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLENGVTISPQDVLKKPIVGRKICILGDCSGVVGDGGVKLCFEADLL
• Gene ID - Mouse: ENSMUSG00000036941
• Gene ID - Rat: ENSRNOG00000000113
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.