Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA040873-100

• 
• 
• 

Protein Description: eukaryotic translation initiation factor 6
Gene Name: EIF6
Alternative Gene Name: b(2)gcn, EIF3A, ITGB4BP, p27BBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027613: 100%, ENSRNOG00000049497: 100%
Entrez Gene ID: 3692
Uniprot ID: P56537
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP
• Gene Sequence: LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP
• Gene ID - Mouse: ENSMUSG00000027613
• Gene ID - Rat: ENSRNOG00000049497
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EIF6 pAb (ATL-HPA040873 w/enhanced validation) – 1 Found

Sun, Liping; Liu, Shuguang; Wang, Xiaopai; Zheng, Xuefeng; Chen, Ya; Shen, Hong. eIF6 promotes the malignant progression of human hepatocellular carcinoma via the mTOR signaling pathway. Journal Of Translational Medicine. 2021;19(1):216.