Anti EIF5B pAb (ATL-HPA034648)

Atlas Antibodies

Catalog No.:
ATL-HPA034648-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 5B
Gene Name: EIF5B
Alternative Gene Name: DKFZp434I036, FLJ10524, IF2, KIAA0741
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026083: 98%, ENSRNOG00000023356: 98%
Entrez Gene ID: 9669
Uniprot ID: O60841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPSK
Gene Sequence QEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPSK
Gene ID - Mouse ENSMUSG00000026083
Gene ID - Rat ENSRNOG00000023356
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF5B pAb (ATL-HPA034648)
Datasheet Anti EIF5B pAb (ATL-HPA034648) Datasheet (External Link)
Vendor Page Anti EIF5B pAb (ATL-HPA034648) at Atlas Antibodies

Documents & Links for Anti EIF5B pAb (ATL-HPA034648)
Datasheet Anti EIF5B pAb (ATL-HPA034648) Datasheet (External Link)
Vendor Page Anti EIF5B pAb (ATL-HPA034648)