Anti EIF5B pAb (ATL-HPA034648)
Atlas Antibodies
- SKU:
- ATL-HPA034648-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EIF5B
Alternative Gene Name: DKFZp434I036, FLJ10524, IF2, KIAA0741
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026083: 98%, ENSRNOG00000023356: 98%
Entrez Gene ID: 9669
Uniprot ID: O60841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPSK |
Gene Sequence | QEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPSK |
Gene ID - Mouse | ENSMUSG00000026083 |
Gene ID - Rat | ENSRNOG00000023356 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EIF5B pAb (ATL-HPA034648) | |
Datasheet | Anti EIF5B pAb (ATL-HPA034648) Datasheet (External Link) |
Vendor Page | Anti EIF5B pAb (ATL-HPA034648) at Atlas Antibodies |
Documents & Links for Anti EIF5B pAb (ATL-HPA034648) | |
Datasheet | Anti EIF5B pAb (ATL-HPA034648) Datasheet (External Link) |
Vendor Page | Anti EIF5B pAb (ATL-HPA034648) |