Anti EIF5A2 pAb (ATL-HPA029090)

Atlas Antibodies

SKU: ATL-HPA029090-25

• 
• 
• 

Protein Description: eukaryotic translation initiation factor 5A2
Gene Name: EIF5A2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050192: 100%, ENSRNOG00000011859: 100%
Entrez Gene ID: 56648
Uniprot ID: Q9GZV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVA
• Gene Sequence: IKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVA
• Gene ID - Mouse: ENSMUSG00000050192
• Gene ID - Rat: ENSRNOG00000011859
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EIF5A2 pAb (ATL-HPA029090) – 1 Found

Murata, Yoshihiko; Minami, Yuko; Iwakawa, Reika; Yokota, Jun; Usui, Shingo; Tsuta, Koji; Shiraishi, Kouya; Sakashita, Shingo; Satomi, Kaishi; Iijima, Tatsuo; Noguchi, Masayuki. ECT2 amplification and overexpression as a new prognostic biomarker for early-stage lung adenocarcinoma. Cancer Science. 2014;105(4):490-7.