Anti EIF5 pAb (ATL-HPA000867 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA000867-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EIF5 antibody. Remaining relative intensity is presented.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 5
Gene Name: EIF5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021282: 100%, ENSRNOG00000010218: 100%
Entrez Gene ID: 1983
Uniprot ID: P55010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD
Gene Sequence MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD
Gene ID - Mouse ENSMUSG00000021282
Gene ID - Rat ENSRNOG00000010218
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EIF5 pAb (ATL-HPA000867 w/enhanced validation)
Datasheet Anti EIF5 pAb (ATL-HPA000867 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EIF5 pAb (ATL-HPA000867 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EIF5 pAb (ATL-HPA000867 w/enhanced validation)
Datasheet Anti EIF5 pAb (ATL-HPA000867 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EIF5 pAb (ATL-HPA000867 w/enhanced validation)