Anti EIF4H pAb (ATL-HPA030542)

Atlas Antibodies

Catalog No.:
ATL-HPA030542-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 4H
Gene Name: EIF4H
Alternative Gene Name: KIAA0038, WBSCR1, WSCR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040731: 99%, ENSRNOG00000001454: 96%
Entrez Gene ID: 7458
Uniprot ID: Q15056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSG
Gene Sequence KDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSG
Gene ID - Mouse ENSMUSG00000040731
Gene ID - Rat ENSRNOG00000001454
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF4H pAb (ATL-HPA030542)
Datasheet Anti EIF4H pAb (ATL-HPA030542) Datasheet (External Link)
Vendor Page Anti EIF4H pAb (ATL-HPA030542) at Atlas Antibodies

Documents & Links for Anti EIF4H pAb (ATL-HPA030542)
Datasheet Anti EIF4H pAb (ATL-HPA030542) Datasheet (External Link)
Vendor Page Anti EIF4H pAb (ATL-HPA030542)