Anti EIF4H pAb (ATL-HPA030542)
Atlas Antibodies
- SKU:
- ATL-HPA030542-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: EIF4H
Alternative Gene Name: KIAA0038, WBSCR1, WSCR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040731: 99%, ENSRNOG00000001454: 96%
Entrez Gene ID: 7458
Uniprot ID: Q15056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSG |
Gene Sequence | KDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSG |
Gene ID - Mouse | ENSMUSG00000040731 |
Gene ID - Rat | ENSRNOG00000001454 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EIF4H pAb (ATL-HPA030542) | |
Datasheet | Anti EIF4H pAb (ATL-HPA030542) Datasheet (External Link) |
Vendor Page | Anti EIF4H pAb (ATL-HPA030542) at Atlas Antibodies |
Documents & Links for Anti EIF4H pAb (ATL-HPA030542) | |
Datasheet | Anti EIF4H pAb (ATL-HPA030542) Datasheet (External Link) |
Vendor Page | Anti EIF4H pAb (ATL-HPA030542) |