Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA025031-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EIF4G3
Alternative Gene Name: eIF4GII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028760: 81%, ENSRNOG00000014368: 78%
Entrez Gene ID: 8672
Uniprot ID: O43432
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EFDSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRESAKPEISAMSA |
| Gene Sequence | EFDSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRESAKPEISAMSA |
| Gene ID - Mouse | ENSMUSG00000028760 |
| Gene ID - Rat | ENSRNOG00000014368 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation) | |
| Datasheet | Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation) | |
| Datasheet | Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation) |