Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA025031-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 4 gamma, 3
Gene Name: EIF4G3
Alternative Gene Name: eIF4GII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028760: 81%, ENSRNOG00000014368: 78%
Entrez Gene ID: 8672
Uniprot ID: O43432
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFDSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRESAKPEISAMSA
Gene Sequence EFDSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRESAKPEISAMSA
Gene ID - Mouse ENSMUSG00000028760
Gene ID - Rat ENSRNOG00000014368
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation)
Datasheet Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation)
Datasheet Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation)