Anti EIF4G3 pAb (ATL-HPA025031 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA025031-25

• 
• 

Protein Description: eukaryotic translation initiation factor 4 gamma, 3
Gene Name: EIF4G3
Alternative Gene Name: eIF4GII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028760: 81%, ENSRNOG00000014368: 78%
Entrez Gene ID: 8672
Uniprot ID: O43432
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EFDSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRESAKPEISAMSA
• Gene Sequence: EFDSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRESAKPEISAMSA
• Gene ID - Mouse: ENSMUSG00000028760
• Gene ID - Rat: ENSRNOG00000014368
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.