Anti EIF4G2 pAb (ATL-HPA006773 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA006773-25

• 
• 
• 

Protein Description: eukaryotic translation initiation factor 4 gamma, 2
Gene Name: EIF4G2
Alternative Gene Name: DAP5, NAT1, p97
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005610: 99%, ENSRNOG00000017158: 99%
Entrez Gene ID: 1982
Uniprot ID: P78344
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDTVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQSQFGEMGGKFMKSQGLSQLYH
• Gene Sequence: QDTVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQSQFGEMGGKFMKSQGLSQLYH
• Gene ID - Mouse: ENSMUSG00000005610
• Gene ID - Rat: ENSRNOG00000017158
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.