Anti EIF4G1 pAb (ATL-HPA028487 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028487-25

• 
• 
• 

Protein Description: eukaryotic translation initiation factor 4 gamma, 1
Gene Name: EIF4G1
Alternative Gene Name: EIF4F, EIF4G, p220, PARK18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045983: 69%, ENSRNOG00000001738: 70%
Entrez Gene ID: 1981
Uniprot ID: Q04637
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QAPTPLASHTVEIHEPNGMVPSEDLEPEVESSPELAPPPACPSESPVPIAPTAQPEELLNGAPSPPAVDLSPVSEPEEQAKEVTASVAPPTIPSATPATA
• Gene Sequence: QAPTPLASHTVEIHEPNGMVPSEDLEPEVESSPELAPPPACPSESPVPIAPTAQPEELLNGAPSPPAVDLSPVSEPEEQAKEVTASVAPPTIPSATPATA
• Gene ID - Mouse: ENSMUSG00000045983
• Gene ID - Rat: ENSRNOG00000001738
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.