Anti EIF4EBP3 pAb (ATL-HPA045537)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045537-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EIF4EBP3
Alternative Gene Name: 4E-BP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090264: 82%, ENSRNOG00000030247: 84%
Entrez Gene ID: 8637
Uniprot ID: O60516
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEM |
Gene Sequence | LLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEM |
Gene ID - Mouse | ENSMUSG00000090264 |
Gene ID - Rat | ENSRNOG00000030247 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EIF4EBP3 pAb (ATL-HPA045537) | |
Datasheet | Anti EIF4EBP3 pAb (ATL-HPA045537) Datasheet (External Link) |
Vendor Page | Anti EIF4EBP3 pAb (ATL-HPA045537) at Atlas Antibodies |
Documents & Links for Anti EIF4EBP3 pAb (ATL-HPA045537) | |
Datasheet | Anti EIF4EBP3 pAb (ATL-HPA045537) Datasheet (External Link) |
Vendor Page | Anti EIF4EBP3 pAb (ATL-HPA045537) |
Citations for Anti EIF4EBP3 pAb (ATL-HPA045537) – 1 Found |
Tsukumo, Yoshinori; Alain, Tommy; Fonseca, Bruno D; Nadon, Robert; Sonenberg, Nahum. Translation control during prolonged mTORC1 inhibition mediated by 4E-BP3. Nature Communications. 2016;7( 27319316):11776. PubMed |