Anti EIF4EBP3 pAb (ATL-HPA045537)

Atlas Antibodies

Catalog No.: ATL-HPA045537-25

Protein Description: eukaryotic translation initiation factor 4E binding protein 3
Gene Name: EIF4EBP3
Alternative Gene Name: 4E-BP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090264: 82%, ENSRNOG00000030247: 84%
Entrez Gene ID: 8637
Uniprot ID: O60516
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEM
• Gene Sequence: LLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEM
• Gene ID - Mouse: ENSMUSG00000090264
• Gene ID - Rat: ENSRNOG00000030247
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EIF4EBP3 pAb (ATL-HPA045537) – 1 Found

Tsukumo, Yoshinori; Alain, Tommy; Fonseca, Bruno D; Nadon, Robert; Sonenberg, Nahum. Translation control during prolonged mTORC1 inhibition mediated by 4E-BP3. Nature Communications. 2016;7( 27319316):11776.