Anti EIF4EBP1 pAb (ATL-HPA023501)

Atlas Antibodies

Catalog No.:
ATL-HPA023501-100
Shipping:
Calculated at Checkout
$520.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 4E binding protein 1
Gene Name: EIF4EBP1
Alternative Gene Name: 4E-BP1, PHAS-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031490: 89%, ENSRNOG00000012582: 92%
Entrez Gene ID: 1978
Uniprot ID: Q13541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Gene Sequence PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Gene ID - Mouse ENSMUSG00000031490
Gene ID - Rat ENSRNOG00000012582
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF4EBP1 pAb (ATL-HPA023501)
Datasheet Anti EIF4EBP1 pAb (ATL-HPA023501) Datasheet (External Link)
Vendor Page Anti EIF4EBP1 pAb (ATL-HPA023501) at Atlas Antibodies

Documents & Links for Anti EIF4EBP1 pAb (ATL-HPA023501)
Datasheet Anti EIF4EBP1 pAb (ATL-HPA023501) Datasheet (External Link)
Vendor Page Anti EIF4EBP1 pAb (ATL-HPA023501)