Anti EIF4EBP1 pAb (ATL-HPA023501)

Atlas Antibodies

Catalog No.: ATL-HPA023501-100

Protein Description: eukaryotic translation initiation factor 4E binding protein 1
Gene Name: EIF4EBP1
Alternative Gene Name: 4E-BP1, PHAS-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031490: 89%, ENSRNOG00000012582: 92%
Entrez Gene ID: 1978
Uniprot ID: Q13541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
• Gene Sequence: PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
• Gene ID - Mouse: ENSMUSG00000031490
• Gene ID - Rat: ENSRNOG00000012582
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.