Anti EIF4E2 pAb (ATL-HPA019253)

Atlas Antibodies

SKU:
ATL-HPA019253-100
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 4E family member 2
Gene Name: EIF4E2
Alternative Gene Name: 4EHP, EIF4EL3, IF4e
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026254: 96%, ENSRNOG00000019634: 95%
Entrez Gene ID: 9470
Uniprot ID: O60573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRL
Gene Sequence TERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRL
Gene ID - Mouse ENSMUSG00000026254
Gene ID - Rat ENSRNOG00000019634
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EIF4E2 pAb (ATL-HPA019253)
Datasheet Anti EIF4E2 pAb (ATL-HPA019253) Datasheet (External Link)
Vendor Page Anti EIF4E2 pAb (ATL-HPA019253) at Atlas Antibodies

Documents & Links for Anti EIF4E2 pAb (ATL-HPA019253)
Datasheet Anti EIF4E2 pAb (ATL-HPA019253) Datasheet (External Link)
Vendor Page Anti EIF4E2 pAb (ATL-HPA019253)