Anti EIF4B pAb (ATL-HPA046164)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046164-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: EIF4B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058655: 97%, ENSRNOG00000010103: 97%
Entrez Gene ID: 1975
Uniprot ID: P23588
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFE |
| Gene Sequence | TTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFE |
| Gene ID - Mouse | ENSMUSG00000058655 |
| Gene ID - Rat | ENSRNOG00000010103 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF4B pAb (ATL-HPA046164) | |
| Datasheet | Anti EIF4B pAb (ATL-HPA046164) Datasheet (External Link) |
| Vendor Page | Anti EIF4B pAb (ATL-HPA046164) at Atlas Antibodies |
| Documents & Links for Anti EIF4B pAb (ATL-HPA046164) | |
| Datasheet | Anti EIF4B pAb (ATL-HPA046164) Datasheet (External Link) |
| Vendor Page | Anti EIF4B pAb (ATL-HPA046164) |