Anti EIF4B pAb (ATL-HPA046164)

Atlas Antibodies

Catalog No.:
ATL-HPA046164-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 4B
Gene Name: EIF4B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058655: 97%, ENSRNOG00000010103: 97%
Entrez Gene ID: 1975
Uniprot ID: P23588
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFE
Gene Sequence TTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFE
Gene ID - Mouse ENSMUSG00000058655
Gene ID - Rat ENSRNOG00000010103
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF4B pAb (ATL-HPA046164)
Datasheet Anti EIF4B pAb (ATL-HPA046164) Datasheet (External Link)
Vendor Page Anti EIF4B pAb (ATL-HPA046164) at Atlas Antibodies

Documents & Links for Anti EIF4B pAb (ATL-HPA046164)
Datasheet Anti EIF4B pAb (ATL-HPA046164) Datasheet (External Link)
Vendor Page Anti EIF4B pAb (ATL-HPA046164)