Anti EIF3L pAb (ATL-HPA003028)

Atlas Antibodies

SKU:
ATL-HPA003028-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic and moderate membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 3, subunit L
Gene Name: EIF3L
Alternative Gene Name: EIF3EIP, EIF3S11, EIF3S6IP, HSPC021, HSPC025
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033047: 99%, ENSRNOG00000011020: 99%
Entrez Gene ID: 51386
Uniprot ID: Q9Y262
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVAR
Gene Sequence RMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVAR
Gene ID - Mouse ENSMUSG00000033047
Gene ID - Rat ENSRNOG00000011020
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EIF3L pAb (ATL-HPA003028)
Datasheet Anti EIF3L pAb (ATL-HPA003028) Datasheet (External Link)
Vendor Page Anti EIF3L pAb (ATL-HPA003028) at Atlas Antibodies

Documents & Links for Anti EIF3L pAb (ATL-HPA003028)
Datasheet Anti EIF3L pAb (ATL-HPA003028) Datasheet (External Link)
Vendor Page Anti EIF3L pAb (ATL-HPA003028)