Anti EIF3I pAb (ATL-HPA029940 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA029940-100

• 
• 

Protein Description: eukaryotic translation initiation factor 3, subunit I
Gene Name: EIF3I
Alternative Gene Name: eIF3-beta, eIF3-p36, eIF3i, EIF3S2, TRIP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028798: 100%, ENSRNOG00000047185: 87%
Entrez Gene ID: 8668
Uniprot ID: Q13347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCG
• Gene Sequence: KYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCG
• Gene ID - Mouse: ENSMUSG00000028798
• Gene ID - Rat: ENSRNOG00000047185
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.