Anti EIF3H pAb (ATL-HPA023117)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023117-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/85185/155312/atl-hpa023117_anti-eif3h-pab-atl-hpa023117_36945__23245.1681105864.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EIF3H
Alternative Gene Name: eIF3-gamma, eIF3-p40, eIF3h, EIF3S3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022312: 98%, ENSRNOG00000040153: 96%
Entrez Gene ID: 8667
Uniprot ID: O15372
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN |
| Gene Sequence | QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN |
| Gene ID - Mouse | ENSMUSG00000022312 |
| Gene ID - Rat | ENSRNOG00000040153 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF3H pAb (ATL-HPA023117) | |
| Datasheet | Anti EIF3H pAb (ATL-HPA023117) Datasheet (External Link) |
| Vendor Page | Anti EIF3H pAb (ATL-HPA023117) at Atlas Antibodies |
| Documents & Links for Anti EIF3H pAb (ATL-HPA023117) | |
| Datasheet | Anti EIF3H pAb (ATL-HPA023117) Datasheet (External Link) |
| Vendor Page | Anti EIF3H pAb (ATL-HPA023117) |
| Citations for Anti EIF3H pAb (ATL-HPA023117) – 1 Found |
| Simsek, Deniz; Tiu, Gerald C; Flynn, Ryan A; Byeon, Gun W; Leppek, Kathrin; Xu, Adele F; Chang, Howard Y; Barna, Maria. The Mammalian Ribo-interactome Reveals Ribosome Functional Diversity and Heterogeneity. Cell. 2017;169(6):1051-1065.e18. PubMed |