Anti EIF3H pAb (ATL-HPA023117)

Atlas Antibodies

SKU:
ATL-HPA023117-25
  • Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in lymphoid cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 3, subunit H
Gene Name: EIF3H
Alternative Gene Name: eIF3-gamma, eIF3-p40, eIF3h, EIF3S3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022312: 98%, ENSRNOG00000040153: 96%
Entrez Gene ID: 8667
Uniprot ID: O15372
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN
Gene Sequence QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN
Gene ID - Mouse ENSMUSG00000022312
Gene ID - Rat ENSRNOG00000040153
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EIF3H pAb (ATL-HPA023117)
Datasheet Anti EIF3H pAb (ATL-HPA023117) Datasheet (External Link)
Vendor Page Anti EIF3H pAb (ATL-HPA023117) at Atlas Antibodies

Documents & Links for Anti EIF3H pAb (ATL-HPA023117)
Datasheet Anti EIF3H pAb (ATL-HPA023117) Datasheet (External Link)
Vendor Page Anti EIF3H pAb (ATL-HPA023117)



Citations for Anti EIF3H pAb (ATL-HPA023117) – 1 Found
Simsek, Deniz; Tiu, Gerald C; Flynn, Ryan A; Byeon, Gun W; Leppek, Kathrin; Xu, Adele F; Chang, Howard Y; Barna, Maria. The Mammalian Ribo-interactome Reveals Ribosome Functional Diversity and Heterogeneity. Cell. 2017;169(6):1051-1065.e18.  PubMed