Anti EIF3G pAb (ATL-HPA041997 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041997-25
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EIF3G antibody. Remaining relative intensity is presented.
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 3, subunit G
Gene Name: EIF3G
Alternative Gene Name: eIF3-delta, eIF3-p44, eIF3g, EIF3S4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070319: 97%, ENSRNOG00000020619: 99%
Entrez Gene ID: 8666
Uniprot ID: O75821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPN
Gene Sequence ICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPN
Gene ID - Mouse ENSMUSG00000070319
Gene ID - Rat ENSRNOG00000020619
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EIF3G pAb (ATL-HPA041997 w/enhanced validation)
Datasheet Anti EIF3G pAb (ATL-HPA041997 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EIF3G pAb (ATL-HPA041997 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EIF3G pAb (ATL-HPA041997 w/enhanced validation)
Datasheet Anti EIF3G pAb (ATL-HPA041997 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EIF3G pAb (ATL-HPA041997 w/enhanced validation)