Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023973-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: EIF3E
Alternative Gene Name: eIF3-p48, eIF3e, EIF3S6, INT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022336: 100%, ENSRNOG00000027690: 100%
Entrez Gene ID: 3646
Uniprot ID: P60228
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY |
Gene Sequence | ARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY |
Gene ID - Mouse | ENSMUSG00000022336 |
Gene ID - Rat | ENSRNOG00000027690 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation) | |
Datasheet | Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation) | |
Datasheet | Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation) |
Citations for Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation) – 1 Found |
V'kovski, Philip; Gerber, Markus; Kelly, Jenna; Pfaender, Stephanie; Ebert, Nadine; Braga Lagache, Sophie; Simillion, Cedric; Portmann, Jasmine; Stalder, Hanspeter; Gaschen, Véronique; Bruggmann, Rémy; Stoffel, Michael H; Heller, Manfred; Dijkman, Ronald; Thiel, Volker. Determination of host proteins composing the microenvironment of coronavirus replicase complexes by proximity-labeling. Elife. 2019;8( 30632963) PubMed |