Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA023973-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 3, subunit E
Gene Name: EIF3E
Alternative Gene Name: eIF3-p48, eIF3e, EIF3S6, INT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022336: 100%, ENSRNOG00000027690: 100%
Entrez Gene ID: 3646
Uniprot ID: P60228
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
Gene Sequence ARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
Gene ID - Mouse ENSMUSG00000022336
Gene ID - Rat ENSRNOG00000027690
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation)
Datasheet Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation)
Datasheet Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation)
Citations for Anti EIF3E pAb (ATL-HPA023973 w/enhanced validation) – 1 Found
V'kovski, Philip; Gerber, Markus; Kelly, Jenna; Pfaender, Stephanie; Ebert, Nadine; Braga Lagache, Sophie; Simillion, Cedric; Portmann, Jasmine; Stalder, Hanspeter; Gaschen, Véronique; Bruggmann, Rémy; Stoffel, Michael H; Heller, Manfred; Dijkman, Ronald; Thiel, Volker. Determination of host proteins composing the microenvironment of coronavirus replicase complexes by proximity-labeling. Elife. 2019;8( 30632963)  PubMed