Anti EIF3D pAb (ATL-HPA045882)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045882-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $303.00
    
         
                            Gene Name: EIF3D
Alternative Gene Name: eIF3-p66, eIF3-zeta, eIF3d, EIF3S7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016554: 99%, ENSRNOG00000005804: 99%
Entrez Gene ID: 8664
Uniprot ID: O15371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | FDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDID | 
| Gene Sequence | FDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDID | 
| Gene ID - Mouse | ENSMUSG00000016554 | 
| Gene ID - Rat | ENSRNOG00000005804 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti EIF3D pAb (ATL-HPA045882) | |
| Datasheet | Anti EIF3D pAb (ATL-HPA045882) Datasheet (External Link) | 
| Vendor Page | Anti EIF3D pAb (ATL-HPA045882) at Atlas Antibodies | 
| Documents & Links for Anti EIF3D pAb (ATL-HPA045882) | |
| Datasheet | Anti EIF3D pAb (ATL-HPA045882) Datasheet (External Link) | 
| Vendor Page | Anti EIF3D pAb (ATL-HPA045882) | 
 
         
                            