Anti EIF3C pAb (ATL-HPA047097)

Atlas Antibodies

Catalog No.:
ATL-HPA047097-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 3, subunit C
Gene Name: EIF3C
Alternative Gene Name: eIF3-p110, eIF3c, EIF3S8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030738: 100%, ENSRNOG00000018761: 100%
Entrez Gene ID: 8663
Uniprot ID: Q99613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHS
Gene Sequence YYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHS
Gene ID - Mouse ENSMUSG00000030738
Gene ID - Rat ENSRNOG00000018761
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF3C pAb (ATL-HPA047097)
Datasheet Anti EIF3C pAb (ATL-HPA047097) Datasheet (External Link)
Vendor Page Anti EIF3C pAb (ATL-HPA047097) at Atlas Antibodies

Documents & Links for Anti EIF3C pAb (ATL-HPA047097)
Datasheet Anti EIF3C pAb (ATL-HPA047097) Datasheet (External Link)
Vendor Page Anti EIF3C pAb (ATL-HPA047097)