Anti EIF3B pAb (ATL-HPA048983)

Atlas Antibodies

Catalog No.:
ATL-HPA048983-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 3, subunit B
Gene Name: EIF3B
Alternative Gene Name: eIF3b, EIF3S9, PRT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056076: 97%, ENSRNOG00000001253: 97%
Entrez Gene ID: 8662
Uniprot ID: P55884
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWE
Gene Sequence PPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWE
Gene ID - Mouse ENSMUSG00000056076
Gene ID - Rat ENSRNOG00000001253
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF3B pAb (ATL-HPA048983)
Datasheet Anti EIF3B pAb (ATL-HPA048983) Datasheet (External Link)
Vendor Page Anti EIF3B pAb (ATL-HPA048983) at Atlas Antibodies

Documents & Links for Anti EIF3B pAb (ATL-HPA048983)
Datasheet Anti EIF3B pAb (ATL-HPA048983) Datasheet (External Link)
Vendor Page Anti EIF3B pAb (ATL-HPA048983)
Citations for Anti EIF3B pAb (ATL-HPA048983) – 2 Found
Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759.  PubMed
van Erp, Susan; van Berkel, Annemiek A; Feenstra, Eline M; Sahoo, Pabitra K; Wagstaff, Laura J; Twiss, Jeffery L; Fawcett, James W; Eva, Richard; Ffrench-Constant, Charles. Age-related loss of axonal regeneration is reflected by the level of local translation. Experimental Neurology. 2021;339( 33450233):113594.  PubMed