Anti EIF3A pAb (ATL-HPA038316 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA038316-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 3, subunit A
Gene Name: EIF3A
Alternative Gene Name: EIF3, eIF3-p170, eIF3-theta, eIF3a, EIF3S10, KIAA0139, TIF32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024991: 99%, ENSRNOG00000010117: 99%
Entrez Gene ID: 8661
Uniprot ID: Q14152
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQ
Gene Sequence PENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQ
Gene ID - Mouse ENSMUSG00000024991
Gene ID - Rat ENSRNOG00000010117
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF3A pAb (ATL-HPA038316 w/enhanced validation)
Datasheet Anti EIF3A pAb (ATL-HPA038316 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EIF3A pAb (ATL-HPA038316 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EIF3A pAb (ATL-HPA038316 w/enhanced validation)
Datasheet Anti EIF3A pAb (ATL-HPA038316 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EIF3A pAb (ATL-HPA038316 w/enhanced validation)