Anti EIF2B4 pAb (ATL-HPA039993)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039993-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: EIF2B4
Alternative Gene Name: DKFZP586J0119, EIF-2B, EIF2B, EIF2Bdelta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029145: 78%, ENSRNOG00000005301: 77%
Entrez Gene ID: 8890
Uniprot ID: Q9UI10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER |
| Gene Sequence | VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER |
| Gene ID - Mouse | ENSMUSG00000029145 |
| Gene ID - Rat | ENSRNOG00000005301 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF2B4 pAb (ATL-HPA039993) | |
| Datasheet | Anti EIF2B4 pAb (ATL-HPA039993) Datasheet (External Link) |
| Vendor Page | Anti EIF2B4 pAb (ATL-HPA039993) at Atlas Antibodies |
| Documents & Links for Anti EIF2B4 pAb (ATL-HPA039993) | |
| Datasheet | Anti EIF2B4 pAb (ATL-HPA039993) Datasheet (External Link) |
| Vendor Page | Anti EIF2B4 pAb (ATL-HPA039993) |