Anti EIF2B4 pAb (ATL-HPA039993)

Atlas Antibodies

Catalog No.:
ATL-HPA039993-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa
Gene Name: EIF2B4
Alternative Gene Name: DKFZP586J0119, EIF-2B, EIF2B, EIF2Bdelta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029145: 78%, ENSRNOG00000005301: 77%
Entrez Gene ID: 8890
Uniprot ID: Q9UI10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER
Gene Sequence VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER
Gene ID - Mouse ENSMUSG00000029145
Gene ID - Rat ENSRNOG00000005301
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF2B4 pAb (ATL-HPA039993)
Datasheet Anti EIF2B4 pAb (ATL-HPA039993) Datasheet (External Link)
Vendor Page Anti EIF2B4 pAb (ATL-HPA039993) at Atlas Antibodies

Documents & Links for Anti EIF2B4 pAb (ATL-HPA039993)
Datasheet Anti EIF2B4 pAb (ATL-HPA039993) Datasheet (External Link)
Vendor Page Anti EIF2B4 pAb (ATL-HPA039993)