Anti EIF2B3 pAb (ATL-HPA024219 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA024219-25

• 
• 
• 

Protein Description: eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
Gene Name: EIF2B3
Alternative Gene Name: EIF-2B, EIF2Bgamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028683: 86%, ENSRNOG00000018375: 84%
Entrez Gene ID: 8891
Uniprot ID: Q9NR50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVG
• Gene Sequence: KEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVG
• Gene ID - Mouse: ENSMUSG00000028683
• Gene ID - Rat: ENSRNOG00000018375
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.