Anti EIF2B3 pAb (ATL-HPA024218)

Atlas Antibodies

SKU:
ATL-HPA024218-25
  • Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
Gene Name: EIF2B3
Alternative Gene Name: EIF-2B, EIF2Bgamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028683: 96%, ENSRNOG00000018375: 95%
Entrez Gene ID: 8891
Uniprot ID: Q9NR50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YPLNLLERVGFEEVIVVTTRDVQKALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDLFRAYDASLAMLMRK
Gene Sequence YPLNLLERVGFEEVIVVTTRDVQKALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDLFRAYDASLAMLMRK
Gene ID - Mouse ENSMUSG00000028683
Gene ID - Rat ENSRNOG00000018375
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EIF2B3 pAb (ATL-HPA024218)
Datasheet Anti EIF2B3 pAb (ATL-HPA024218) Datasheet (External Link)
Vendor Page Anti EIF2B3 pAb (ATL-HPA024218) at Atlas Antibodies

Documents & Links for Anti EIF2B3 pAb (ATL-HPA024218)
Datasheet Anti EIF2B3 pAb (ATL-HPA024218) Datasheet (External Link)
Vendor Page Anti EIF2B3 pAb (ATL-HPA024218)