Anti EIF2B3 pAb (ATL-HPA024213)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024213-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: EIF2B3
Alternative Gene Name: EIF-2B, EIF2Bgamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028683: 96%, ENSRNOG00000018375: 95%
Entrez Gene ID: 8891
Uniprot ID: Q9NR50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQG |
| Gene Sequence | QRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQG |
| Gene ID - Mouse | ENSMUSG00000028683 |
| Gene ID - Rat | ENSRNOG00000018375 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EIF2B3 pAb (ATL-HPA024213) | |
| Datasheet | Anti EIF2B3 pAb (ATL-HPA024213) Datasheet (External Link) |
| Vendor Page | Anti EIF2B3 pAb (ATL-HPA024213) at Atlas Antibodies |
| Documents & Links for Anti EIF2B3 pAb (ATL-HPA024213) | |
| Datasheet | Anti EIF2B3 pAb (ATL-HPA024213) Datasheet (External Link) |
| Vendor Page | Anti EIF2B3 pAb (ATL-HPA024213) |
| Citations for Anti EIF2B3 pAb (ATL-HPA024213) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |