Anti EIF2AK4 pAb (ATL-HPA011811)

Atlas Antibodies

SKU:
ATL-HPA011811-100
  • Immunohistochemical staining of human gallbladder shows weak cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 2 alpha kinase 4
Gene Name: EIF2AK4
Alternative Gene Name: GCN2, KIAA1338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005102: 80%, ENSRNOG00000006027: 86%
Entrez Gene ID: 440275
Uniprot ID: Q9P2K8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSPGSCEILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNALETATGGFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVRYLAMNLKEQDDSIVVDILVEHISGVSLAAHL
Gene Sequence DSPGSCEILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNALETATGGFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVRYLAMNLKEQDDSIVVDILVEHISGVSLAAHL
Gene ID - Mouse ENSMUSG00000005102
Gene ID - Rat ENSRNOG00000006027
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EIF2AK4 pAb (ATL-HPA011811)
Datasheet Anti EIF2AK4 pAb (ATL-HPA011811) Datasheet (External Link)
Vendor Page Anti EIF2AK4 pAb (ATL-HPA011811) at Atlas Antibodies

Documents & Links for Anti EIF2AK4 pAb (ATL-HPA011811)
Datasheet Anti EIF2AK4 pAb (ATL-HPA011811) Datasheet (External Link)
Vendor Page Anti EIF2AK4 pAb (ATL-HPA011811)