Anti EIF2AK1 pAb (ATL-HPA016496)

Atlas Antibodies

SKU:
ATL-HPA016496-25
  • Immunohistochemical staining of human corpus, uterine shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 2-alpha kinase 1
Gene Name: EIF2AK1
Alternative Gene Name: HRI, KIAA1369
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029613: 92%, ENSRNOG00000001050: 92%
Entrez Gene ID: 27102
Uniprot ID: Q9BQI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDPEYDESDVPAEIQVLKEPLQQPTFPFAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGR
Gene Sequence PDPEYDESDVPAEIQVLKEPLQQPTFPFAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGR
Gene ID - Mouse ENSMUSG00000029613
Gene ID - Rat ENSRNOG00000001050
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EIF2AK1 pAb (ATL-HPA016496)
Datasheet Anti EIF2AK1 pAb (ATL-HPA016496) Datasheet (External Link)
Vendor Page Anti EIF2AK1 pAb (ATL-HPA016496) at Atlas Antibodies

Documents & Links for Anti EIF2AK1 pAb (ATL-HPA016496)
Datasheet Anti EIF2AK1 pAb (ATL-HPA016496) Datasheet (External Link)
Vendor Page Anti EIF2AK1 pAb (ATL-HPA016496)