Anti EIF2A pAb (ATL-HPA036256)

Atlas Antibodies

SKU: ATL-HPA036256-25

• 
• 
• 

Protein Description: eukaryotic translation initiation factor 2A, 65kDa
Gene Name: EIF2A
Alternative Gene Name: EIF-2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027810: 98%, ENSRNOG00000013393: 96%
Entrez Gene ID: 83939
Uniprot ID: Q9BY44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNA
• Gene Sequence: VLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNA
• Gene ID - Mouse: ENSMUSG00000027810
• Gene ID - Rat: ENSRNOG00000013393
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EIF2A pAb (ATL-HPA036256) – 1 Found

Liu, Yanbin; Zhang, Hui; Li, Xingzhi; Zhang, Changming; Huang, Haide. Identification of anti-tumoral feedback loop between VHLα and hnRNPA2B1 in renal cancer. Cell Death & Disease. 2020;11(8):688.