Anti EIF2A pAb (ATL-HPA036256)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036256-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EIF2A
Alternative Gene Name: EIF-2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027810: 98%, ENSRNOG00000013393: 96%
Entrez Gene ID: 83939
Uniprot ID: Q9BY44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNA |
Gene Sequence | VLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNA |
Gene ID - Mouse | ENSMUSG00000027810 |
Gene ID - Rat | ENSRNOG00000013393 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EIF2A pAb (ATL-HPA036256) | |
Datasheet | Anti EIF2A pAb (ATL-HPA036256) Datasheet (External Link) |
Vendor Page | Anti EIF2A pAb (ATL-HPA036256) at Atlas Antibodies |
Documents & Links for Anti EIF2A pAb (ATL-HPA036256) | |
Datasheet | Anti EIF2A pAb (ATL-HPA036256) Datasheet (External Link) |
Vendor Page | Anti EIF2A pAb (ATL-HPA036256) |
Citations for Anti EIF2A pAb (ATL-HPA036256) – 1 Found |
Liu, Yanbin; Zhang, Hui; Li, Xingzhi; Zhang, Changming; Huang, Haide. Identification of anti-tumoral feedback loop between VHLα and hnRNPA2B1 in renal cancer. Cell Death & Disease. 2020;11(8):688. PubMed |