Anti EIF1AD pAb (ATL-HPA054991)

Atlas Antibodies

Catalog No.:
ATL-HPA054991-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: eukaryotic translation initiation factor 1A domain containing
Gene Name: EIF1AD
Alternative Gene Name: haponin, MGC11102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024841: 93%, ENSRNOG00000020463: 94%
Entrez Gene ID: 84285
Uniprot ID: Q8N9N8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVDPIE
Gene Sequence TKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVDPIE
Gene ID - Mouse ENSMUSG00000024841
Gene ID - Rat ENSRNOG00000020463
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EIF1AD pAb (ATL-HPA054991)
Datasheet Anti EIF1AD pAb (ATL-HPA054991) Datasheet (External Link)
Vendor Page Anti EIF1AD pAb (ATL-HPA054991) at Atlas Antibodies

Documents & Links for Anti EIF1AD pAb (ATL-HPA054991)
Datasheet Anti EIF1AD pAb (ATL-HPA054991) Datasheet (External Link)
Vendor Page Anti EIF1AD pAb (ATL-HPA054991)