Anti EID2 pAb (ATL-HPA045477)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045477-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EID2
Alternative Gene Name: CRI2, EID-2, MGC20452
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046058: 90%, ENSRNOG00000019310: 90%
Entrez Gene ID: 163126
Uniprot ID: Q8N6I1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE |
Gene Sequence | AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE |
Gene ID - Mouse | ENSMUSG00000046058 |
Gene ID - Rat | ENSRNOG00000019310 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EID2 pAb (ATL-HPA045477) | |
Datasheet | Anti EID2 pAb (ATL-HPA045477) Datasheet (External Link) |
Vendor Page | Anti EID2 pAb (ATL-HPA045477) at Atlas Antibodies |
Documents & Links for Anti EID2 pAb (ATL-HPA045477) | |
Datasheet | Anti EID2 pAb (ATL-HPA045477) Datasheet (External Link) |
Vendor Page | Anti EID2 pAb (ATL-HPA045477) |