Anti EID2 pAb (ATL-HPA045477)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045477-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: EID2
Alternative Gene Name: CRI2, EID-2, MGC20452
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046058: 90%, ENSRNOG00000019310: 90%
Entrez Gene ID: 163126
Uniprot ID: Q8N6I1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE |
| Gene Sequence | AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE |
| Gene ID - Mouse | ENSMUSG00000046058 |
| Gene ID - Rat | ENSRNOG00000019310 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EID2 pAb (ATL-HPA045477) | |
| Datasheet | Anti EID2 pAb (ATL-HPA045477) Datasheet (External Link) |
| Vendor Page | Anti EID2 pAb (ATL-HPA045477) at Atlas Antibodies |
| Documents & Links for Anti EID2 pAb (ATL-HPA045477) | |
| Datasheet | Anti EID2 pAb (ATL-HPA045477) Datasheet (External Link) |
| Vendor Page | Anti EID2 pAb (ATL-HPA045477) |