Anti EID2 pAb (ATL-HPA045477)

Atlas Antibodies

Catalog No.:
ATL-HPA045477-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: EP300 interacting inhibitor of differentiation 2
Gene Name: EID2
Alternative Gene Name: CRI2, EID-2, MGC20452
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046058: 90%, ENSRNOG00000019310: 90%
Entrez Gene ID: 163126
Uniprot ID: Q8N6I1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE
Gene Sequence AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE
Gene ID - Mouse ENSMUSG00000046058
Gene ID - Rat ENSRNOG00000019310
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EID2 pAb (ATL-HPA045477)
Datasheet Anti EID2 pAb (ATL-HPA045477) Datasheet (External Link)
Vendor Page Anti EID2 pAb (ATL-HPA045477) at Atlas Antibodies

Documents & Links for Anti EID2 pAb (ATL-HPA045477)
Datasheet Anti EID2 pAb (ATL-HPA045477) Datasheet (External Link)
Vendor Page Anti EID2 pAb (ATL-HPA045477)